Recombinant Bacillus anthracis  UPF0295 protein BAA_0600 (BAA_0600)

Recombinant Bacillus anthracis UPF0295 protein BAA_0600 (BAA_0600)

CSB-CF503625BQF
Regular price
€1.006,95 EUR
Sale price
€1.006,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus anthracis (strain A0248)

Uniprot NO.:C3PD00

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRDLEGKEFDEKYNKKSYKS

Protein Names:Recommended name: UPF0295 protein BAA_0600

Gene Names:Ordered Locus Names:BAA_0600

Expression Region:1-118

Sequence Info:full length protein

Your list is ready to share