Gene Bio Systems
Recombinant Bacillus amyloliquefaciens Protein psiE homolog(psiE)
Recombinant Bacillus amyloliquefaciens Protein psiE homolog(psiE)
SKU:CSB-CF419419BQD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus amyloliquefaciens (strain FZB42)
Uniprot NO.:A7Z6Z1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRFSNNFKKAPYLLQALLNVCLFFLAIALSGLLISETWYIVQFVYKSLFNKVDSYYEMLG ELLIFFMYFEFIALIIKYFKSDFHFPLRYFIYIGITAVIRLIIIDHDQAISTFWWAMAIL AMICAFFIVNRRNSVVEH
Protein Names:Recommended name: Protein psiE homolog
Gene Names:Name:psiE Ordered Locus Names:RBAM_024070
Expression Region:1-138
Sequence Info:full length protein
