Skip to product information
1 of 1

Gene Bio Systems

Recombinant Azorhizobium caulinodans UPF0060 membrane protein AZC_0909 (AZC_0909)

Recombinant Azorhizobium caulinodans UPF0060 membrane protein AZC_0909 (AZC_0909)

SKU:CSB-CF426880DPR

Regular price €1.391,95 EUR
Regular price Sale price €1.391,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / ORS 571)

Uniprot NO.:A8HU57

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLPLFALAALAEIAGCFAFWHVVRAGGSPLWLAPGVLSLVAFAALLTQVEADAAGRAFA AYGGIYILASLGWMWAAEGVRPDRFDALGAAICLAGACVILFAPRG

Protein Names:Recommended name: UPF0060 membrane protein AZC_0909

Gene Names:Ordered Locus Names:AZC_0909

Expression Region:1-106

Sequence Info:full length protein

View full details