Skip to product information
1 of 1

Gene Bio Systems

Recombinant Azorhizobium caulinodans Cbb3-type cytochrome c oxidase subunit FixP(fixP)

Recombinant Azorhizobium caulinodans Cbb3-type cytochrome c oxidase subunit FixP(fixP)

SKU:CSB-CF422769DPR

Regular price €1.576,95 EUR
Regular price Sale price €1.576,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / ORS 571)

Uniprot NO.:A8HZ17

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTSHESHHAPVDGAGGPSTTGHEWDGIQELNNPLPRWWLWTFYATIIWAFGYWVAYPAW PLVSNYTSGVLGWNSRSAVVEQISDLQKLRAASSAKLANVPLEDIEKNPELLSLARAEGK VAFADNCAPCHGAGGGGAKGFPNLNDDDWLWGGTLAQIQQTITHGIRSGDDEGHQGNMLA FGSILSKADISNVADYVRSLSGAAPGDTPAAKKGAEIFAANCATCHGENGKGNQELGSKN LTDGIWLYGGDKATIVQTITNGRGGVMPAWGPRLSPTTIKALTVYVHTLGGGQ

Protein Names:Recommended name: Cbb3-type cytochrome c oxidase subunit FixP Short name= Cbb3-Cox subunit FixP Alternative name(s): C-type cytochrome FixP Short name= Cyt c(FixP) Cytochrome c oxidase subunit III

Gene Names:Name:fixP Ordered Locus Names:AZC_4526

Expression Region:1-293

Sequence Info:full length protein

View full details