Gene Bio Systems
Recombinant Azoarcus sp. UPF0060 membrane protein azo2656 (azo2656)
Recombinant Azoarcus sp. UPF0060 membrane protein azo2656 (azo2656)
SKU:CSB-CF374398AVL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Azoarcus sp. (strain BH72)
Uniprot NO.:A1K8W8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTELKTLLLFLATAVAEIVGCYLPYRWLREDGSAWLLLPAAASLALFAWLLTLHPAASGR IYAAYGGVYVFVAVLWLWGVDGVRPTVWDITGSLIALCGMAVIMFAPRGA
Protein Names:Recommended name: UPF0060 membrane protein azo2656
Gene Names:Ordered Locus Names:azo2656
Expression Region:1-110
Sequence Info:full length protein
