Skip to product information
1 of 1

Gene Bio Systems

Recombinant Avian infectious bronchitis virus Replicase polyprotein 1ab(rep),partial

Recombinant Avian infectious bronchitis virus Replicase polyprotein 1ab(rep),partial

SKU:CSB-BP318280ARV

Regular price €1.379,95 EUR
Regular price Sale price €1.379,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:others

Uniprot ID:P12723

Gene Names:rep

Organism:Avian infectious bronchitis virus (strain KB8523) (IBV)

AA Sequence:GGGGQSFLAADNAVLVSTQCYKRHSYVEIPSNLLVQNGMSLKDGANLYVYKRVNGAFVTLPNTLNTQGRSYETFEPRSDVERDFLDMSEEDFVEKYGKDLGLQHILYGEVDKPQLGGLHTVIGMYRLLRANKLNAKSVTNSDSDVMQNYFVLADNGSYKQVCTVVDLLLDDFLELLRNILNEYGTNKSKVVTVSIDYHSINFMTWFEDGSIKTCYPQLQ

Expression Region:1-219aa

Sequence Info:Partial

Source:Baculovirus

Tag Info:C-terminal 6xHis-tagged

MW:30.1 kDa

Alternative Name(s):pp1ab;ORF1ab polyprotein

Relevance:The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products. NendoU is a Mn2+-dependent, uridylate-specific enzyme, which leaves 2'-3'-cyclic phosphates 5' to the cleaved bond.

Reference:"Cloning and sequencing of genes encoding structural proteins of avian infectious bronchitis virus." Sutou S., Sato S., Okabe T., Nakai M., Sasaki N. Virology 165:589-595(1988)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details