Skip to product information
1 of 1

Gene Bio Systems

Recombinant ATP synthase subunit b(atpF)

Recombinant ATP synthase subunit b(atpF)

SKU:CSB-CF002358DPP

Regular price €1.441,95 EUR
Regular price Sale price €1.441,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Azobacteroides pseudotrichonymphae genomovar. CFP2

Uniprot NO.:B6YR08

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLLTPDIGLLFWMLLSFGIVFFVAAKYGFPVIVKMVDERNAFINKSLEEAKQANKRLRGIKEEEERLLKETYNKRIFIIKEANEMRIKIINDAKEKANFESNRLMKNAKENIQKEKELAMQDIRQQIAALSIDIAERVLRKSLDNKHEQLNLINELIKELN

Protein Names:Recommended name: ATP synthase subunit b Alternative name(s): ATP synthase F(0) sector subunit b ATPase subunit I F-type ATPase subunit b Short name= F-ATPase subunit b

Gene Names:Name:atpF Ordered Locus Names:CFPG_367

Expression Region:1-162

Sequence Info:full length protein

View full details