Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ashbya gossypii Solute carrier family 25 member 38 homolog(AGR383W)

Recombinant Ashbya gossypii Solute carrier family 25 member 38 homolog(AGR383W)

SKU:CSB-CF748318DOT

Regular price €1.582,95 EUR
Regular price Sale price €1.582,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Uniprot NO.:Q74Z23

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSEKAGGVPAHLVSGFFGGLASVCALQPLDLLKTRLQQAQASSLRSVLREVRTTRELWRG TLPSALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSRAAVGL VTMPITVIKVRYESTLYAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYVLLY EQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSASLATTLTAPFDTIKTRMQL QSHPVGFVQTLRHIVCEERARTLFDGLSLRLCRKAMSACIAWGIYEELLKLLH

Protein Names:Recommended name: Solute carrier family 25 member 38 homolog

Gene Names:Ordered Locus Names:AGR383W ORF Names:AGOS_AGR383W

Expression Region:1-293

Sequence Info:full length protein

View full details