Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ashbya gossypii Protein ROT1(ROT1)

Recombinant Ashbya gossypii Protein ROT1(ROT1)

SKU:CSB-CF748356DOT

Regular price €1.513,95 EUR
Regular price Sale price €1.513,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Uniprot NO.:Q755J8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QSAKDLYGTWSAKSNQVFTGPGFYNPADELLIEPSLPGISYSFTEDGFFEMATYRVSGNP RNLACPSAVMTFQHGKYEILANGTLILRPFEVDGRQLVSEPCVDKGVSTYLRYSQVETFQ RFAVELDEYQGKHALHLFQFDGSPVQPLYLAYRPPLMLPTITLNPTDHAGATATAGPGHR KRSLGELVRAGLQDKHKTTAVRNPSLFNAAFYWWCSAGVIAAGTVLFFMV

Protein Names:Recommended name: Protein ROT1

Gene Names:Name:ROT1 Ordered Locus Names:AFL175C

Expression Region:24-253

Sequence Info:full length protein

View full details