
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Uniprot NO.:O28269
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSPDTEEQTGLTIYLYPVIAWIILVTKIESGLRTRTFPVVHGDEGNNLIPLPEDVKNIRI VQSWPDTFLAKATVGAETIDMGIHVSPDVEALKKEAIELIKHKGSLRKAKKDAERESIVS GWFQSKFQSELLNLKKGWRIRGIVRAESPESKTLFNIELIKRVERRKDASHLRSGVFTPY QKSRIEDIPLSQRKIEPGEVDVPIPYDGIYRIAISPNVKTTYFVELFVEKGS
Protein Names:Recommended name: Uncharacterized protein AF_2010
Gene Names:Ordered Locus Names:AF_2010
Expression Region:1-232
Sequence Info:full length protein
You may also like
-
Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2025 (AF_2025)
- Regular price
- €1.316,95 EUR
- Sale price
- €1.316,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1096 (AF_1096)
- Regular price
- €1.280,95 EUR
- Sale price
- €1.280,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1016 (AF_1016)
- Regular price
- €1.292,95 EUR
- Sale price
- €1.292,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0924 (AF_0924)
- Regular price
- €1.329,95 EUR
- Sale price
- €1.329,95 EUR
- Regular price
-
- Unit price
- per
Sold out