Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arbacia lixula NADH-ubiquinone oxidoreductase chain 1(ND1)

Recombinant Arbacia lixula NADH-ubiquinone oxidoreductase chain 1(ND1)

SKU:CSB-CF654244ANK-GB

Regular price €1.399,95 EUR
Regular price Sale price €1.399,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arbacia lixula (Black urchin) (Echinus lixula)

Uniprot NO.:Q33756

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYAYIFAFFELITFLVPVLLAVAFLTLVERKVLGYMQFRKGPNVVGLTDFCNLFADGLKL FIKETVKPSSASPYLFFASPVLFLTLALLLWNFMPVTSPALDLQLSLLLVLGLSSLSVYA ILGSG

Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 1 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 1

Gene Names:Name:ND1

Expression Region:1-125

Sequence Info:full length protein

View full details