Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Vacuolar iron transporter homolog 2.1(At3g25190)

Recombinant Arabidopsis thaliana Vacuolar iron transporter homolog 2.1(At3g25190)

SKU:CSB-CF864830DOA

Regular price €1.507,95 EUR
Regular price Sale price €1.507,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9LSF6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTSNVQLSETNSPRNQKTRPRAEKEEVDYMQRAQWLRAALLGANDGLVTVASLMMGVGSI KEDVKAMLLVGFAGLVAGACSMAIGEFVSVCTQRDIETAQMKRAIEHKTSLSAIDEQEEE EKKERLPNPGQAAIASALAFSVGAAMPLLGAVFIENHKVRMVVVAVVATIALVVFGVTGA VLGKTSVVKSSVRVVIGGWMAMALTFGLTKFIGSAAMQI

Protein Names:Recommended name: Vacuolar iron transporter homolog 2.1 Alternative name(s): Protein NODULIN-LIKE 21

Gene Names:Ordered Locus Names:At3g25190 ORF Names:MJL12.26

Expression Region:1-219

Sequence Info:full length protein

View full details