Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana RING-H2 finger protein ATL67(ATL67)

Recombinant Arabidopsis thaliana RING-H2 finger protein ATL67(ATL67)

SKU:CSB-CF528092DOA

Regular price €1.491,95 EUR
Regular price Sale price €1.491,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O82353

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTLASSASVFLVHPPLPPSPPQAGNHSYLTTLGFGYSIAIALGFLVLLSTVLLSSYICC RDSRRRTTAVESTGDRGGSVILPRIIFVAEEDNEDLEAGDVVVGLDQAVINSYPKFHFSK DTSAASSDGFGGGGDTTCSICLCEYKEAEMLRMMPECKHYFHLCCLDAWLKLNGSCPVCR NSPLPTPTSTPLSTPLSEVVPLSQYAADRRRARR

Protein Names:Recommended name: RING-H2 finger protein ATL67

Gene Names:Name:ATL67 Ordered Locus Names:At2g46160 ORF Names:T3F17.19

Expression Region:1-214

Sequence Info:full length protein

View full details