Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana RING-H2 finger protein ATL40(ATL40)

Recombinant Arabidopsis thaliana RING-H2 finger protein ATL40(ATL40)

SKU:CSB-CF882900DOA

Regular price €1.492,95 EUR
Regular price Sale price €1.492,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9SLC4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSNNKTDDSDDRSFWQNSTSYDASSKIFLVTTVSFSIIIIIVFVYYLYAKFVLHRRSAF QDLSFSVVSQPPKRGLDSLVIASLPTFVVGIKNDVAGTECAVCLSLLEEKDNARMLPNCK HVFHVSCVDTWLTTQSTCPVCRTEAEPSHPRLEPEPREGPVGDFAPPLDFAGVDNKTGGS SVSRLDSFRRILTRERSSNRRDHSRVDQDRELDIERQ

Protein Names:Recommended name: RING-H2 finger protein ATL40

Gene Names:Name:ATL40 Ordered Locus Names:At2g42350 ORF Names:MHK10.7

Expression Region:1-217

Sequence Info:full length protein

View full details