Gene Bio Systems
Recombinant Arabidopsis thaliana Reticulon-like protein B23(RTNLB23)
Recombinant Arabidopsis thaliana Reticulon-like protein B23(RTNLB23)
SKU:CSB-CF317507DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:P0C941
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGEMGKAIGLLISGTLVYHHCANRNATLLSLISDVLIVLLSSLAILGLLFRHLNVSVPVD PLEWQISQDTACNIVARLANTVGAAESVLRVAATGHDKRLFVKVVICLYFLAALGRIISG VTIAYAGLCLFCLSMLFRSSIRNSVLNRRNGEILD
Protein Names:Recommended name: Reticulon-like protein B23 Short name= AtRTNLB23
Gene Names:Name:RTNLB23 Ordered Locus Names:At1g16825 ORF Names:F17F16.24
Expression Region:1-155
Sequence Info:full length protein
