Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Probable transmembrane ascorbate ferrireductase 2(CYB561B)

Recombinant Arabidopsis thaliana Probable transmembrane ascorbate ferrireductase 2(CYB561B)

SKU:CSB-CF890463DOA

Regular price €1.506,95 EUR
Regular price Sale price €1.506,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9SWS1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAVPVLGGFPIFMVVRVLGFIIAALVLTWTVHYRGGLALSSDNKDHIFNVHPVMMVIGLI LFNGEAMLAYKSVQGTKNLKKLVHLTLQLTAFILSLIGVWAALKFHIDKGIENFYSLHSW LGLACLFLFAFQWAAGFVTYWYPGGSRNSRASLMPWHVFLGISIYALALVTATTGILEKV TFLQVNQVITRYSTEAMLVNTMGVLILILGGFVILGVVTPVSGKDQVLTQ

Protein Names:Recommended name: Probable transmembrane ascorbate ferrireductase 2 EC= 1.16.5.1 Alternative name(s): Cytochrome b561-1 Short name= Artb561-2 Short name= AtCytb561

Gene Names:Name:CYB561B Synonyms:ACYB-1, CYB-1, CYTB561 Ordered Locus Names:At5g38630 ORF Names:MBB18.18

Expression Region:1-230

Sequence Info:full length protein

View full details