Gene Bio Systems
Recombinant Arabidopsis thaliana Probable signal peptidase complex subunit 1(At2g22425)
Recombinant Arabidopsis thaliana Probable signal peptidase complex subunit 1(At2g22425)
SKU:CSB-CF842443DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q944J0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDWQGQKLVEQLMQILLVISGVVAVVVGYTTESFRTMMLIYAGGVVLTTLVTVPNWPFYN LHPLKWLDPSEAEKHPKPEVVSVASKKKFSKK
Protein Names:Recommended name: Probable signal peptidase complex subunit 1 EC= 3.4.-.- Alternative name(s): Microsomal signal peptidase 12 kDa subunit Short name= SPase 12 kDa subunit
Gene Names:Ordered Locus Names:At2g22425 ORF Names:F14M13.3
Expression Region:1-92
Sequence Info:full length protein