Recombinant Arabidopsis thaliana Probable signal peptidase complex subunit 1(At2g22425)

SKU: CSB-CF842443DOA

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q944J0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDWQGQKLVEQLMQILLVISGVVAVVVGYTTESFRTMMLIYAGGVVLTTLVTVPNWPFYN LHPLKWLDPSEAEKHPKPEVVSVASKKKFSKK

Protein Names:Recommended name: Probable signal peptidase complex subunit 1 EC= 3.4.-.- Alternative name(s): Microsomal signal peptidase 12 kDa subunit Short name= SPase 12 kDa subunit

Gene Names:Ordered Locus Names:At2g22425 ORF Names:F14M13.3

Expression Region:1-92

Sequence Info:full length protein