Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Probable protein cornichon homolog 2(At1g12340)

Recombinant Arabidopsis thaliana Probable protein cornichon homolog 2(At1g12340)

SKU:CSB-CF661671DOA

Regular price €1.402,95 EUR
Regular price Sale price €1.402,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q3EDD7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRGVTETDKLANGIFHLVCLADLEFDYINPYDSASRINSVVLPEFIVQGVLCVFYLLTGH WFMTLLCLPYLYYNFHLYSKRQHLVDVTEIFNLLNWEKKKRLFKLAYIVLNLFLTIFWMI YSALDDYED

Protein Names:Recommended name: Probable protein cornichon homolog 2

Gene Names:Ordered Locus Names:At1g12340 ORF Names:F5O11.7

Expression Region:1-129

Sequence Info:full length protein

View full details