Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Probable cytochrome b5 isoform 2 (At2g32720)

Recombinant Arabidopsis thaliana Probable cytochrome b5 isoform 2 (At2g32720)

SKU:CSB-CF526173DOA

Regular price €1.421,95 EUR
Regular price Sale price €1.421,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O48845

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGDEAKIFTLSEVSEHNQAHDCWIVINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFE DVGHSESAREMMEQYYVGEIDPTTIPKKVKYTPPKQPHYNQDKTSEFIIKLLQFLVPLAI LGLAVGIRIYTKSG

Protein Names:Recommended name: Probable cytochrome b5 isoform 2

Gene Names:Ordered Locus Names:At2g32720 ORF Names:F24L7.14

Expression Region:1-134

Sequence Info:full length protein

View full details