Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Probable CDP-diacylglycerol--inositol 3-phosphatidyltransferase 2(PIS2)

Recombinant Arabidopsis thaliana Probable CDP-diacylglycerol--inositol 3-phosphatidyltransferase 2(PIS2)

SKU:CSB-CF814083DOA

Regular price €1.512,95 EUR
Regular price Sale price €1.512,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q8GUK6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKQRPATLSVYLYIPNIVGYMRVLLNCIAFSVCFSNKTLFSLLYFFSFCCDAVDGWCAR KFNQVSTFGAVLDMVTDRVSTACLLVILSQIYRPSLVFLSLLALDIASHWLQMYSTFLSG KTSHKDVKDSTSWLFRLYYGNRMFMGYCCVSCEVLYIILLLIATNQTENLMNVVVKSLMQ ISPLSLLLALSIFGWSIKQIINVIQMKTAADVCVLYDIEKQHKKP

Protein Names:Recommended name: Probable CDP-diacylglycerol--inositol 3-phosphatidyltransferase 2 EC= 2.7.8.11 Alternative name(s): Phosphatidylinositol synthase 2 Short name= AtPIS2 Short name= PI synthase 2 Short name= PtdIns synth

Gene Names:Name:PIS2 Ordered Locus Names:At4g38570 ORF Names:F20M13.130

Expression Region:1-225

Sequence Info:full length protein

View full details