Gene Bio Systems
Recombinant Arabidopsis thaliana Preprotein translocase subunit SECE1(SECE1)
Recombinant Arabidopsis thaliana Preprotein translocase subunit SECE1(SECE1)
SKU:CSB-CF519535DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:O23342
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TMTTSNLRKSACFVAKAIEQRRDTAGSESESEATPSPAEESGSGEDKEVEISAIGAEIKA AMEQRKTAEEEKGKNEFLSGVAEEVKEIEWPAFQKVLGTTGVVLGVIAGSSVVLLTVNFL LAELSDRVFIGRGVQDFFS
Protein Names:Recommended name: Preprotein translocase subunit SECE1
Gene Names:Name:SECE1 Ordered Locus Names:At4g14870 ORF Names:dl3475w, FCAALL.408
Expression Region:39-177
Sequence Info:full length protein
