Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Preprotein translocase subunit SECE1(SECE1)

Recombinant Arabidopsis thaliana Preprotein translocase subunit SECE1(SECE1)

SKU:CSB-CF519535DOA

Regular price €1.422,95 EUR
Regular price Sale price €1.422,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O23342

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TMTTSNLRKSACFVAKAIEQRRDTAGSESESEATPSPAEESGSGEDKEVEISAIGAEIKA AMEQRKTAEEEKGKNEFLSGVAEEVKEIEWPAFQKVLGTTGVVLGVIAGSSVVLLTVNFL LAELSDRVFIGRGVQDFFS

Protein Names:Recommended name: Preprotein translocase subunit SECE1

Gene Names:Name:SECE1 Ordered Locus Names:At4g14870 ORF Names:dl3475w, FCAALL.408

Expression Region:39-177

Sequence Info:full length protein

View full details