Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana PRA1 family protein E(PRA1E)

Recombinant Arabidopsis thaliana PRA1 family protein E(PRA1E)

SKU:CSB-CF867008DOA

Regular price €1.484,95 EUR
Regular price Sale price €1.484,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9FRR1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNQKPPPYGYGGAGGGGVGPSSTSNTTIIGTLSARAKQTTQSMITTLRPWREILDLSALS LPRGYDEAMAHLKHNISYFRGNYALAVLAIVFLGLIYHPMSMIAFIVVFIGWILLYFSRD ANDSIVISGKEVDDKIVLVLLSLVTVLALVYTDVGENVLVSLIIGLLIVGAHGAFRNTDD LFLDEESARRGGLVSAGSGNRPPSSYTPI

Protein Names:Recommended name: PRA1 family protein E Short name= AtPRA1.E Alternative name(s): Prenylated Rab acceptor 4

Gene Names:Name:PRA1E Synonyms:PRA4 Ordered Locus Names:At1g08770 ORF Names:F22O13.26

Expression Region:1-209

Sequence Info:full length protein

View full details