Gene Bio Systems
Recombinant Arabidopsis thaliana PRA1 family protein C(PRA1C)
Recombinant Arabidopsis thaliana PRA1 family protein C(PRA1C)
SKU:CSB-CF627345DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q1G3K7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIFRTNYIVIFIVSIFISMLWQPVHLSVFVILIVAWLYVYSRDNEPWVIFGSVIDDSTLV LVLLVLTIGIFLLTDVSRGIVIGVLAGLPVVLVHGMCRRNTEMLFVLEDDEEKVAMNTSS SSLSSSS
Protein Names:Recommended name: PRA1 family protein C Short name= AtPRA1.C
Gene Names:Name:PRA1C Ordered Locus Names:At4g29658 ORF Names:T16L4.170
Expression Region:1-127
Sequence Info:full length protein
