Gene Bio Systems
Recombinant Arabidopsis thaliana Photosystem I reaction center subunit III, chloroplastic(PSAF)
Recombinant Arabidopsis thaliana Photosystem I reaction center subunit III, chloroplastic(PSAF)
SKU:CSB-CF886678DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9SHE8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:DISGLTPCKDSKQFAKREKQQIKKLESSLKLYAPESAPALALNAQIEKTKRRFDNYGKYG LLCGSDGLPHLIVNGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAISGEKKPAMKEII IDVPLASRIIFRGFIWPVAAYREFLNGDLIAKDV
Protein Names:Recommended name: Photosystem I reaction center subunit III, chloroplastic Alternative name(s): Light-harvesting complex I 17 kDa protein PSI-F
Gene Names:Name:PSAF Ordered Locus Names:At1g31330 ORF Names:T19E23.12
Expression Region:68-221
Sequence Info:full length protein
