Gene Bio Systems
Recombinant Arabidopsis thaliana NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13-A(MEE4)
Recombinant Arabidopsis thaliana NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13-A(MEE4)
SKU:CSB-CF819318DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q8RWA7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTEAMIRNKPGMASVKDMPLLQDGPPPGGFAPVRYARRISNTGPSAMAMFLAVSGAFAWG MYQVGQGNKIRRALKEEKYAARRTILPILQAEEDERFVSEWKKYLEYEADVMKDVPGWKV GENVYNSGRWMPPATGELRPDVW
Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13-A Alternative name(s): Protein MATERNAL EFFECT EMBRYO ARREST 4
Gene Names:Name:MEE4 Ordered Locus Names:At1g04630 ORF Names:T1G11.12
Expression Region:1-143
Sequence Info:full length protein
![Recombinant Arabidopsis thaliana NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13-A(MEE4)](http://www.genebiosystems.com/cdn/shop/products/no_image_default_image-jpeg_61d22ebd-a11b-4ccc-9ead-758ad2673897.jpg?v=1659245406&width=1445)