Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Membrane steroid-binding protein 2(MSBP2)

Recombinant Arabidopsis thaliana Membrane steroid-binding protein 2(MSBP2)

SKU:CSB-CF885526DOA-GB

Regular price €1.519,95 EUR
Regular price Sale price €1.519,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9M2Z4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVQQIWETLKETITAYTGLSPAAFFTVLALAFAVYQVVSGFFVSPEVHRPRSLEVQPQSE PLPPPVQLGEITEEELKLYDGSDSKKPLLMAIKGQIYDVSQSRMFYGPGGPYALFAGKDA SRALAKMSFEDQDLTGDISGLGAFELEALQDWEYKFMSKYVKVGTIQKKDGEGKESSEPS EAKTASAEGLSTNTGEEASAITHDETSRSTGEKIAETTEKKDVATDDDDAAKE

Protein Names:Recommended name: Membrane steroid-binding protein 2 Short name= AtMP2

Gene Names:Name:MSBP2 Synonyms:MP2 Ordered Locus Names:At3g48890 ORF Names:T21J18_160

Expression Region:1-233

Sequence Info:full length protein

View full details