Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Ergosterol biosynthetic protein 28 (At1g10030)

Recombinant Arabidopsis thaliana Ergosterol biosynthetic protein 28 (At1g10030)

SKU:CSB-CF526812DOA

Regular price €1.416,95 EUR
Regular price Sale price €1.416,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O80594

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKALGYWLMVVGSLRLASVWFGFFNIWALRLAVFSQTTMSEVHGRTFGVWTLLTCTLCFL CAFNLENKPLYLATFLSFIYALGHFLTEYLFYQTMTIANLSTVGFFAGTSIVWMLLEWNS LEQPHSKLS

Protein Names:Recommended name: Ergosterol biosynthetic protein 28

Gene Names:Ordered Locus Names:At1g10030 ORF Names:T27I1.5

Expression Region:1-129

Sequence Info:full length protein

View full details