Gene Bio Systems
Recombinant Arabidopsis thaliana Copper transporter 6(COPT6)
Recombinant Arabidopsis thaliana Copper transporter 6(COPT6)
SKU:CSB-CF816752DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q8GWP3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDHGNMPPSSPSSMVNHTNSNMIMMHMTFFWGKNTEILFSGWPGTSLGMYVLCLIVVFLL AVIVEWLAHSSILRGRGSTSRAKGLVQTAVYTLKTGLAYLVMLAVMSFNGGVFIVAIAGF AVGFMLFGSTAFKNPSDDEKPFEQL
Protein Names:Recommended name: Copper transporter 6 Short name= AtCOPT6
Gene Names:Name:COPT6 Ordered Locus Names:At2g26975
Expression Region:1-145
Sequence Info:full length protein
