Gene Bio Systems
Recombinant Arabidopsis thaliana Copper transporter 5(COPT5)
Recombinant Arabidopsis thaliana Copper transporter 5(COPT5)
SKU:CSB-CF821947DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q93VM8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MMHMTFYWGIKATILFDFWKTDSWLSYILTLIACFVFSAFYQYLENRRIQFKSLSSSRRA PPPPRSSSGVSAPLIPKSGTRSAAKAASVLLFGVNAAIGYLLMLAAMSFNGGVFIAIVVG LTAGYAVFRSDDGGADTATDDPCPCA
Protein Names:Recommended name: Copper transporter 5 Short name= AtCOPT5
Gene Names:Name:COPT5 Ordered Locus Names:At5g20650 ORF Names:T1M15.50
Expression Region:1-146
Sequence Info:full length protein
