Gene Bio Systems
Recombinant Arabidopsis thaliana Copper transporter 4(COPT4)
Recombinant Arabidopsis thaliana Copper transporter 4(COPT4)
SKU:CSB-CF851432DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q8SAA5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLSSKNVVVVEAWNTTTTTQTQTPHRPSLLHPTFYWGYNCQVLFSGWPGSDRGMYALALI FVFFLAFLAEWLARCSDASSIKQGADKLAKVAFRTAMYTVKSGFSYLVILAVVSFNGGVF LAAIFGHALGFAVFRGRAFRNRDIQ
Protein Names:Recommended name: Copper transporter 4 Short name= AtCOPT4
Gene Names:Name:COPT4 Ordered Locus Names:At2g37925 ORF Names:T8P21.17
Expression Region:1-145
Sequence Info:full length protein
