Gene Bio Systems
Recombinant Arabidopsis thaliana Copper transporter 2(COPT2)
Recombinant Arabidopsis thaliana Copper transporter 2(COPT2)
SKU:CSB-CF871155DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9STG2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDHDHMHDMPPPSPSSSSMSNHTTPHMMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLI VIFLLAVIAEWLAHSPILRVSGSTNRAAGLAQTAVYTLKTGLSYLVMLAVMSFNAGVFIV AIAGYGVGFFLFGSTTFKKPSDDQKTAELLPPSSGCVC
Protein Names:Recommended name: Copper transporter 2 Short name= AtCOPT2
Gene Names:Name:COPT2 Ordered Locus Names:At3g46900 ORF Names:T6H20.70
Expression Region:1-158
Sequence Info:full length protein
