Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein CP29.2, chloroplastic(LHCB4.2)

Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein CP29.2, chloroplastic(LHCB4.2)

SKU:CSB-CF893562DOA

Regular price €1.545,95 EUR
Regular price Sale price €1.545,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q9XF88

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RFGFGTKKASPKKAKTVISDRPLWFPGAKSPEYLDGSLVGDYGFDPFGLGKPAEYLQFDL DSLDQNLAKNLYGEVIGTRTEAVDPKSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGA ITVEWLTGVTWQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVIGYIEFQRNAELDSEK RLYPGGKFFDPLGLASDPVKKAQLQLAEIKHARLAMVGFLGFAVQAAATGKGPLNNWATH LSDPLHTTIIDTFSSS

Protein Names:Recommended name: Chlorophyll a-b binding protein CP29.2, chloroplastic Alternative name(s): LHCB4.2 LHCII protein 4.2

Gene Names:Name:LHCB4.2 Ordered Locus Names:At3g08940 ORF Names:T16O11.12

Expression Region:32-287

Sequence Info:full length protein

View full details