Gene Bio Systems
Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein 1, chloroplastic(LHCB1.3)
Recombinant Arabidopsis thaliana Chlorophyll a-b binding protein 1, chloroplastic(LHCB1.3)
SKU:CSB-CF361365DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:P04778
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:RKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARN RELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHA QSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKE LKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK
Protein Names:Recommended name: Chlorophyll a-b binding protein 1, chloroplastic Alternative name(s): Chlorophyll a-b protein 140 Short name= CAB-140 LHCII type I CAB-1
Gene Names:Name:LHCB1.3 Synonyms:AB140, CAB1 Ordered Locus Names:At1g29930 ORF Names:F1N18.3
Expression Region:36-267
Sequence Info:full length protein
