Gene Bio Systems
Recombinant Arabidopsis thaliana CASP-like protein At3g14380(At3g14380)
Recombinant Arabidopsis thaliana CASP-like protein At3g14380(At3g14380)
SKU:CSB-CF888826DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9LUL1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDKTDQTAIDESALVLNRTEKSAEAVLRVASMALSITGLVIMIKNSISNEFGSVSYSNIG AFMYLVSANGVCAAYSLLSALAILALPCPISKVQVRTLFLLDQVVTYVVLAAGAVSAETV YLAYYGNIPITWSSACDSYGSFCHNALISVVFTFVVSLLYMLLSLISSYRLFTRFEAP
Protein Names:Recommended name: CASP-like protein At3g14380
Gene Names:Ordered Locus Names:At3g14380 ORF Names:MLN21.16
Expression Region:1-178
Sequence Info:full length protein
