Gene Bio Systems
Recombinant Arabidopsis thaliana 3-hydroxyacyl-CoA dehydratase PASTICCINO 2(PAS2)
Recombinant Arabidopsis thaliana 3-hydroxyacyl-CoA dehydratase PASTICCINO 2(PAS2)
SKU:CSB-CF823812DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q8VZB2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAGFLSVVRRVYLTLYNWIVFAGWAQVLYLAITTLKETGYENVYDAIEKPLQLAQTAAVL EILHGLVGLVRSPVSATLPQIGSRLFLTWGILYSFPEVRSHFLVTSLVISWSITEIIRYS FFGFKEALGFAPSWHLWLRYSSFLLLYPTGITSEVGLIYLALPHIKTSEMYSVRMPNILN FSFDFFYATILVLAIYVPGSPHMYRYMLGQRKRALSKSKRE
Protein Names:Recommended name: 3-hydroxyacyl-CoA dehydratase PASTICCINO 2 Short name= AtPAS2 Short name= HACD EC= 4.2.1.- Alternative name(s): Protein PEPINO Short name= PEP Protein tyrosine phosphatase-like protein
Gene Names:Name:PAS2 Synonyms:PEP Ordered Locus Names:At5g10480 ORF Names:F12B17.170
Expression Region:1-221
Sequence Info:full length protein
