Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_492333 (ARALYDRAFT_492333)

Recombinant Arabidopsis lyrata subsp. lyrata CASP-like protein ARALYDRAFT_492333 (ARALYDRAFT_492333)

SKU:CSB-CF520614DNZ

Regular price €1.453,95 EUR
Regular price Sale price €1.453,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)

Uniprot NO.:D7MGK0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMGDNEGRRTPLLNLGVQVSMRVLIIGAAMASMWVMITNREVASVYGIAFEAKYSYSSAF RYLVYAQIAVCAATLFTLVWACLAVRRRGLVFALFFFDLLTTLTAISAFSAAFAEGYVGK YGNKQAGWLPICGYVHVYCSRVTISLAMSFASFVLLFILTVLTASSARHY

Protein Names:Recommended name: CASP-like protein ARALYDRAFT_492333

Gene Names:ORF Names:ARALYDRAFT_492333

Expression Region:1-170

Sequence Info:full length protein

View full details