Skip to product information
1 of 1

Gene Bio Systems

Recombinant Aquifex aeolicus Uncharacterized protein aq_1078 (aq_1078)

Recombinant Aquifex aeolicus Uncharacterized protein aq_1078 (aq_1078)

SKU:CSB-CF530247DNV

Regular price €1.501,95 EUR
Regular price Sale price €1.501,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Aquifex aeolicus (strain VF5)

Uniprot NO.:O67171

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYLENCIVILTSTTPPWWAIPPAWSLGAEIQAYFLLPILLTYKMLGLSVFWISYIIYSLA NLNIIHSDYFGYRLIPGVIFMFLSGAYLQKIVSGKASRLEMLSLIIIYIISLFWLVFFII IKGKYGAYTRETLLGLLVGIPLVYTLLKIRRKFYFNDLFGKLSYGIFLSHFLSFWILEFV NLTQNIISMIFLSLIISASVSYLIITLIENKVEKIRYNLTR

Protein Names:Recommended name: Uncharacterized protein aq_1078

Gene Names:Ordered Locus Names:aq_1078

Expression Region:1-221

Sequence Info:full length protein

View full details