Gene Bio Systems
Recombinant Aquareovirus C Non-structural protein 5(S7)
Recombinant Aquareovirus C Non-structural protein 5(S7)
SKU:CSB-CF809063AHAG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Aquareovirus C (isolate Golden shiner/USA/GSRV/1977) (AQRV-C)
Uniprot NO.:Q8JU56
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPCQDTVSLSIQHTSVYVQHSCCVSTSTSASTSATALGLGCLACGIVGVLVVAGGLCCLI NGRCPSCRRLALRSRSWKSPPASLCTNQPLAFNLRDLTRSDIRCTSDPRSVELLSDVHSV VSHRERPPAYDSLDFEPTEYTPEAFQ
Protein Names:Recommended name: Non-structural protein 5 Short name= NS5
Gene Names:Name:S7
Expression Region:1-146
Sequence Info:full length protein
