Skip to product information
1 of 1

Gene Bio Systems

Recombinant Apomastus schlingeri U1-cyrtautoxin-As1c

Recombinant Apomastus schlingeri U1-cyrtautoxin-As1c

SKU:CSB-EP344579AMR

Regular price €1.022,95 EUR
Regular price Sale price €1.022,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P49270

Gene Names: N/A

Organism: Apomastus schlingeri

AA Sequence: EIPQNLGSGIPHDKIKLPNGQWCKTPGDLCSSSSECCKAKHSNSVTYASFCSRQWSGQQALFINQCRTCNVESSMC

Expression Region: 1-76aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 12.3 kDa

Alternative Name(s): Aptotoxin VI Aptotoxin-6 Paralytic peptide VI Short name:PP VI

Relevance: Is both paralytic and lethal, when injected into lepidopteran larvae.

Reference: "Identification of insecticidal peptides from venom of the trap-door spider, Aptostichus schlingeri (Ctenizidae)."Skinner W.S., Dennis P.A., Li J.P., Quistad G.B.Toxicon 30:1043-1050(1992)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details