Skip to product information
1 of 1

Gene Bio Systems

Recombinant Apium graveolens Chlorophyll a-b binding protein, chloroplastic(LHC0)

Recombinant Apium graveolens Chlorophyll a-b binding protein, chloroplastic(LHC0)

SKU:CSB-CF310897DNL

Regular price €1.504,95 EUR
Regular price Sale price €1.504,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Apium graveolens (Celery)

Uniprot NO.:P92919

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RKTVKAPVSDSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRE LEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQS ILSIWATQVILMGAVEGYRVAGGPLGEIVDPLYPGGSFDPLGLAEDPERSAELKVKELKN GRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein, chloroplastic Alternative name(s): Allergen= Api g 3

Gene Names:Name:LHC0

Expression Region:36-264

Sequence Info:full length protein

View full details