Skip to product information
1 of 1

Gene Bio Systems

Recombinant Antifungal protein(afp)

Recombinant Antifungal protein(afp)

SKU:CSB-EP325933APN

Regular price €1.022,95 EUR
Regular price Sale price €1.022,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Microbiology

Uniprot ID: P17737

Gene Names: afp

Organism: Aspergillus giganteus

AA Sequence: ATYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCYC

Expression Region: 44-94aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-B2M-tagged

MW: 19.8 kDa

Alternative Name(s):

Relevance: This protein inhibits the growth of a variety of fungal species.

Reference: "NMR solution structure of the antifungal protein from Aspergillus giganteus: evidence for cysteine pairing isomerism."Campos-Olivas R., Bruix M., Santoro J., Lacadena J., Martinez del Pozo A., Gavilanes J.G., Rico M.Biochemistry 34:3009-3021(1995) .

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details