Skip to product information
1 of 1

Gene Bio Systems

Recombinant Anas platyrhynchos NADH-ubiquinone oxidoreductase chain 1(MT-ND1)

Recombinant Anas platyrhynchos NADH-ubiquinone oxidoreductase chain 1(MT-ND1)

SKU:CSB-CF015076BZD-GB

Regular price €1.390,95 EUR
Regular price Sale price €1.390,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Anas platyrhynchos (Domestic duck) (Anas boschas)

Uniprot NO.:P50658

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPQTTMVSYLIMALLYIIPILIAVAFLTLVERKILSYMQSRKGPNIVGPFGLLQPIADGI KLFIKEPIRPSTSSPLLFIMMPMLALLLALTAWVPLPLPFSLVDLNLGVLFMVAMSS

Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 1 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 1

Gene Names:Name:MT-ND1 Synonyms:MTND1, NADH1, ND1

Expression Region:1-117

Sequence Info:full length protein

View full details