Gene Bio Systems
Recombinant Anaplasma phagocytophilum 50S ribosomal protein L22(rplV)
Recombinant Anaplasma phagocytophilum 50S ribosomal protein L22(rplV)
SKU:CSB-CF641281AAAQ
Couldn't load pickup availability
Size: 10ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 15-20 working days
Research Topic: Epigenetics and Nuclear Signaling
Uniprot ID: Q2GL54
Gene Names: rplV
Organism: Anaplasma phagocytophilum (strain HZ)
AA Sequence: MSIVIAAKGLGLRSTPAKLNLVADLIRGKDVAVAAMYLKFCKKKAALLIDKVLKSAIANARANYGVDADNLYVKEVLVGKAFTLRRVQPRARGRACRISKRYGSVVVKLLER
Expression Region: 1-112aa
Sequence Info: Full Length
Source: in vitro E.coli expression system
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW: 32.2 kDa
Alternative Name(s):
Relevance: This protein binds specifically to 23S rRNA; its binding is stimulated by other ribosomal proteins, e.g. L4, L17, and L20. It is important during the early stages of 50S assembly. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome.
Reference: "Comparative genomics of emerging human ehrlichiosis agents."Dunning Hotopp J.C., Lin M., Madupu R., Crabtree J.Tettelin H. PLoS Genet. 2:208-222(2006)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
