Skip to product information
1 of 1

Gene Bio Systems

Recombinant Anabaena variabilis Cytochrome b6-f complex iron-sulfur subunit 1(petC)

Recombinant Anabaena variabilis Cytochrome b6-f complex iron-sulfur subunit 1(petC)

SKU:CSB-CF864710BYN

Regular price €1.461,95 EUR
Regular price Sale price €1.461,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Anabaena variabilis (strain ATCC 29413 / PCC 7937)

Uniprot NO.:Q9L3P9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAQFSESVDVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPATGGAGGGTTAKDEL GNDVSVSKFLESHNVGDRTLVQGLKGDPTYIVVESKEAITDYGINAVCTHLGCVVPWNAA ENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTENDKIVLTPWTETDFRTGEEPWWS

Protein Names:Recommended name: Cytochrome b6-f complex iron-sulfur subunit 1 EC= 1.10.9.1 Alternative name(s): Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein Short name= ISP Short name= RISP Rieske iron-sulfur prote

Gene Names:Name:petC Ordered Locus Names:Ava_0385

Expression Region:1-179

Sequence Info:full length protein

View full details