Skip to product information
1 of 1

GeneBio Systems

Recombinant Amaranthus caudatus Antimicrobial peptide 2

Recombinant Amaranthus caudatus Antimicrobial peptide 2

SKU:P27275

Regular price €849,95 EUR
Regular price Sale price €849,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P27275

Gene Names: N/A

Alternative Name(s): (AMP2)(AMP1)

Abbreviation: Recombinant Amaranthus caudatus Antimicrobial peptide 2 protein

Organism: Amaranthus caudatus (Love-lies-bleeding) (Inca-wheat)

Source: E.coli

Expression Region: 26-55aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal GST-tagged

Target Protein Sequence: VGECVRGRCPSGMCCSQFGYCGKGPKYCGR

MW: 29.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Required for assembly of the protein secretion apparatus HSI-I. Actively secreted during chronic infection of cystic fibrosis patients.

Reference: "Cryo-EM structure of a type IV secretion system." Mace K., Vadakkepat A.K., Redzej A., Lukoyanova N., Oomen C., Braun N., Ukleja M., Lu F., Costa T.R.D., Orlova E.V., Baker D., Cong Q., Waksman G. Nature 607: 191-196(2022)

Function:

View full details