Gene Bio Systems
Recombinant Aliivibrio salmonicida Protein CrcB homolog(crcB)
Recombinant Aliivibrio salmonicida Protein CrcB homolog(crcB)
SKU:CSB-CF471663AZM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Aliivibrio salmonicida (strain LFI1238) (Vibrio salmonicida (strain LFI1238))
Uniprot NO.:B6EGU9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNQFMLLGFIAFGGAFGACARYLISELCVVLLGKGFPYGTLTVNIVGSLIMGVLMSSLNQ GIIEAAPCRPIIGLGFLGALTTFSTFSMDNVILMQQGEVIKAGLNILLNVTLSITACFIG FQLMKS
Protein Names:Recommended name: Protein CrcB homolog
Gene Names:Name:crcB Ordered Locus Names:VSAL_I2981
Expression Region:1-126
Sequence Info:full length protein
