Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ajellomyces capsulata Vacuolar ATPase assembly integral membrane protein VMA21(VMA21)

Recombinant Ajellomyces capsulata Vacuolar ATPase assembly integral membrane protein VMA21(VMA21)

SKU:CSB-CF025866AUN

Regular price €1.381,95 EUR
Regular price Sale price €1.381,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ajellomyces capsulata (strain NAm1 / WU24) (Darling's disease fungus) (Histoplasma capsulatum)

Uniprot NO.:A6R3V7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASRRSAAAKKEDFSFEAAATQSAHEAQEGFPSSVIIKLVLVTVAMICAPLGTYFGTLNT ICGGDSSYAGALAAISVNVVLIIYLIIAAREDTGESEEERKGKEGKEE

Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21

Gene Names:Name:VMA21 ORF Names:HCAG_04315

Expression Region:1-108

Sequence Info:full length protein

View full details