Skip to product information
1 of 1

GeneBio Systems

Recombinant African swine fever virus CD2 homolog, partial

Recombinant African swine fever virus CD2 homolog, partial

SKU:Q89501

Regular price €805,95 EUR
Regular price Sale price €805,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q89501

Gene Names: N/A

Alternative Name(s): CD2H;5HL;CD2v;T-lymphocyte CD2 receptor-like protein;CD2-like protein;pEP402R

Abbreviation: Recombinant African swine fever virus CD2 homolog protein, partial

Organism: African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)

Source: Yeast

Expression Region: 17-204aa

Protein Length: Partial

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: NIIIWSTLNQTVFLNNIFTINDTYGGLFWNTYYDNNRSNFTYCGIAGNYCSCCGHNISLYNTTNNCSLIIFPNNTEIFNRTYELVYLDKKINYTVKLLKSVDSPTITYNCTNSLITCKNNNGTNVNIYLIINNTIVNDTNGDILNYYWNGNNNFTATCMINNTISSLNETENINCTNPILKYQNYLST

MW: 23.0 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: May play an immunosuppressive role by inhibiting lymphocyte proliferation and subsequently facilitating viral replication and generalization of infection. Responsible for viral hemadsorption, which may help viral spread. Increases virus replication in the tick vector at the step of virus uptake or replication in the tick gut. May play a role in the host Golgi reorganization to yield viral factories. May play a role in host cell penetration.

Reference:

Function:

View full details