Recombinant Aequorea victoria Green fluorescent protein(GFP)

Recombinant Aequorea victoria Green fluorescent protein(GFP)

CSB-EP337004ADOa2
Regular price
€738,95 EUR
Sale price
€738,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: GFP

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Aequorea victoria (Jellyfish)

Delivery time: 3-7 business days

Uniprot ID: P42212 

AA Sequence: MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-238aa

Protein length: Full Length

MW: 42.9 kDa

Alternative Name(s):

Relevance: Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca2+-activated photoprotein aequorin.

Reference: "A molecular thermometer based on fluorescent protein blinking."Wong F.H., Banks D.S., Abu-Arish A., Fradin C.J. Am. Chem. Soc. 129:10302-10303(2007)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share