Gene Bio Systems
Recombinant Aegilops crassa Chloroplast envelope membrane protein(cemA)
Recombinant Aegilops crassa Chloroplast envelope membrane protein(cemA)
SKU:CSB-CF303982ADJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Aegilops crassa (Persian goatgrass) (Triticum crassum)
Uniprot NO.:P69374
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKKKKALPSLLYLVFIVLLPWGVSSSFNKCLELWIKNWWNTRQSETLLTDIQEKRILERF IELEELSLLDEMIKGKLKTHVQKPPTGIHKEIIQWVKINNEDHLHTILHFSTNIICLAIL SGSFFLGKEELVILNSWVQEFFYNLNDSIKA
Protein Names:Recommended name: Chloroplast envelope membrane protein
Gene Names:Name:cemA Synonyms:ycf10
Expression Region:1-151
Sequence Info:full length protein
